PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_07447.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 267aa    MW: 30167.7 Da    PI: 7.5373
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_07447.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.59.4e-112876348
                             SS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwqkyl 48
                              WT eE +++ +a +    +    +W++Ia+ ++ g+t ++++ r+ k+l
  Rsa1.0_07447.1_g00001.1 28 TWTVEENKRFEKALAFIDDKedveSWSKIAALIP-GKTVYDVIKRYKKLL 76
                             7*****************99**************.************986 PP

2Myb_DNA-binding49.97.3e-16148192347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +WT+eE+ +++ + k++G+g+W+ Iar + ++Rt+ q+ s+ qky
  Rsa1.0_07447.1_g00001.1 148 PWTEEEHRRFLMGLKKYGKGDWRNIARNFVTTRTPTQVASHAQKY 192
                              8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-51777IPR009057Homeodomain-like
PROSITE profilePS500906.5042176IPR017877Myb-like domain
SuperFamilySSF466892.08E-92382IPR009057Homeodomain-like
SMARTSM007172.0E-62578IPR001005SANT/Myb domain
PfamPF002493.2E-82876IPR001005SANT/Myb domain
CDDcd001671.43E-72876No hitNo description
PROSITE profilePS5129422.32141197IPR017930Myb domain
SuperFamilySSF466891.65E-17143196IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-18144196IPR006447Myb domain, plants
SMARTSM007171.9E-13145195IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-13145192IPR009057Homeodomain-like
PfamPF002495.3E-13148192IPR001005SANT/Myb domain
CDDcd001673.03E-11148193No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MSSTNGDGFK CFSPENTNWI FQEVKDVTWT VEENKRFEKA LAFIDDKEDV ESWSKIAALI  60
PGKTVYDVIK RYKKLLDDVS DIEAGLVPDP RYGYDASSET TCDYFFGLEN SSCGYGYDYV  120
VGGKRSTPAM ADGFRAPIPE KERKKGVPWT EEEHRRFLMG LKKYGKGDWR NIARNFVTTR  180
TPTQVASHAQ KYFIRQLTDC KDKRRSSIHD ITTVNVPDAN ASTTTTPAAA TVSPTPANPF  240
DVFLPKPHHS FAFSPASSYH NTFPQWS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006398645.11e-157hypothetical protein EUTSA_v10014410mg
SwissprotQ8S9H71e-71DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLV4LJX81e-157V4LJX8_EUTSA; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_60000791e-140(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148841619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01200.11e-134MYB family protein